CDS

Accession Number TCMCG002C05831
gbkey CDS
Protein Id XP_020084976.1
Location <15291836..15292222
Gene LOC109707861
GeneID 109707861
Organism Ananas comosus

Protein

Length 128aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA371634
db_source XM_020229387.1
Definition oleosin 16 kDa, partial [Ananas comosus]

EGGNOG-MAPPER Annotation

COG_category U
Description May have a structural role to stabilize the lipid body during desiccation of the seed by preventing coalescence of the oil. Probably interacts with both lipid and phospholipid moieties of lipid bodies. May also provide recognition signals for specific lipase anchorage in lipolysis during seedling growth
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE -
KEGG_ko -
EC -
KEGG_Pathway -
GOs GO:0000003        [VIEW IN EMBL-EBI]
GO:0003006        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005576        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005811        [VIEW IN EMBL-EBI]
GO:0006950        [VIEW IN EMBL-EBI]
GO:0007275        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0009266        [VIEW IN EMBL-EBI]
GO:0009409        [VIEW IN EMBL-EBI]
GO:0009628        [VIEW IN EMBL-EBI]
GO:0009791        [VIEW IN EMBL-EBI]
GO:0009845        [VIEW IN EMBL-EBI]
GO:0010154        [VIEW IN EMBL-EBI]
GO:0010344        [VIEW IN EMBL-EBI]
GO:0010876        [VIEW IN EMBL-EBI]
GO:0016020        [VIEW IN EMBL-EBI]
GO:0019915        [VIEW IN EMBL-EBI]
GO:0019953        [VIEW IN EMBL-EBI]
GO:0022414        [VIEW IN EMBL-EBI]
GO:0032501        [VIEW IN EMBL-EBI]
GO:0032502        [VIEW IN EMBL-EBI]
GO:0033036        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043228        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043232        [VIEW IN EMBL-EBI]
GO:0044085        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0044703        [VIEW IN EMBL-EBI]
GO:0048316        [VIEW IN EMBL-EBI]
GO:0048608        [VIEW IN EMBL-EBI]
GO:0048731        [VIEW IN EMBL-EBI]
GO:0048856        [VIEW IN EMBL-EBI]
GO:0050826        [VIEW IN EMBL-EBI]
GO:0050896        [VIEW IN EMBL-EBI]
GO:0051179        [VIEW IN EMBL-EBI]
GO:0051235        [VIEW IN EMBL-EBI]
GO:0051704        [VIEW IN EMBL-EBI]
GO:0061458        [VIEW IN EMBL-EBI]
GO:0065007        [VIEW IN EMBL-EBI]
GO:0065008        [VIEW IN EMBL-EBI]
GO:0071840        [VIEW IN EMBL-EBI]
GO:0090351        [VIEW IN EMBL-EBI]

Sequence

CDS:  
CAGCAGCAGCAGCAGCAGCCGATGATGATGACGGCGGTGAAGGCGGCGACGGCGGCGACGGCGGGGGGTTCGATGCTGGTGCTGTCGGGGCTGACGCTGGCGGGGACGGTGATCGCGCTGACGGTGGCGACGCCGCTGCTGGTGATATTCAGCCCCGTGCTGGTGCCGGCGACGATCGCAGTGTCGCTGCTGGCGGCGGGGTTCGTGACGTCGGGGGGGCTGGGCTTGGCGGCGCTGTCGGTGCTGTCGTGGATGTACAAGTACCTGACCGGGAAACACCCCCCGGGGGCCGACCAGCTCGAACACGCCAAGGCCAGGCTCGCCTCCAAGGCCCGCGACATCAAGGAATCGGCGCAGCACCGGATCGACCAAGCCCAGGGATCTTAA
Protein:  
QQQQQQPMMMTAVKAATAATAGGSMLVLSGLTLAGTVIALTVATPLLVIFSPVLVPATIAVSLLAAGFVTSGGLGLAALSVLSWMYKYLTGKHPPGADQLEHAKARLASKARDIKESAQHRIDQAQGS